PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g040410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 725aa    MW: 81505.5 Da    PI: 6.5186
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g040410.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS377.31.9e-1153507191374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+av+++d ++a +lL++++ +++p gd +qRla++f+++L+arla+++s++yk + +++ s    + +l+a++lf  ++P+ k+s+
  Csa06g040410.1 350 LRSLLIHCAQAVAADDRRCAGQLLKQIRLHSTPFGDGNQRLAHCFANGLEARLAGTGSQIYKGIVSKPRS---AAAVLKAHQLFLACCPFRKLSY 441
                     689***************************************************************9999...999******************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +++N++I + v++++rvH+iDf+i +G+QWp+L++ ++    g+p++RiTg++ p++g   ++++eetg+rLa +A+++gvpfe+++ +ak++++
  Csa06g040410.1 442 FITNKTIRDLVDNSQRVHVIDFGILYGFQWPTLIHRFSM--YGSPMVRITGIEFPQPGfrPAQRVEETGQRLAAYAKHFGVPFEYKA-IAKKWDA 533
                     **************************************9..8***************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L+++++E+++Vn+ ++ ++l+desv++es+rd+vL+l+ +++P+++v+   +  +n++ F++rf eal ++s++fd+le+ +pre+e r+
  Csa06g040410.1 534 IQLEDLDIDRDEVIIVNCLYRAENLHDESVKVESCRDTVLNLIGKINPDLFVFGIVNGAYNAPFFVTRFREALFHFSSIFDMLETIVPREDEGRM 628
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++E e++gre+ nv+aceg er+er et+++W+ r +++G+ +vp++ +++k+a + +++++ + + +++++ +l++gWk+r+++++S+W+
  Csa06g040410.1 629 FLEMEVFGREALNVIACEGWERVERPETYKQWHVRAMRSGLVQVPFDPSIMKTALHKVNTFYHKDFVIDQDNRWLLQGWKGRTVMALSVWK 719
                     **************************************************************889*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.731324699IPR005202Transcription factor GRAS
PfamPF035146.7E-113350719IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MITEPGLTGI SAAITRNRLP GLPDQSTSLL PNHTFTPVSL YDGFNYNLSS SDHRNPAENS  60
VFLREVVVGE EEDPADDFDF SDAVLGYISQ MLNEEDMDDK VCMLQESLDL EAAERSLYEA  120
IGKKYPPSPE RNLVASFSER NGENLDRVVP VNYTGCDCIG FGNGGIKPLS SGGFTFDFRN  180
PQSLCSSVLS VPQSNGFEID ESSSKKSLYS DSNRESHQSV WLFRRGIEEA SRLLPEQNEL  240
IVNFREEICM SRGRKNSSRD EISVEEERSS KLPAVFGEDI LRSDVVDKIL VHVPGEESMK  300
EFDALREVLK KGVEKKKASV AQGGKRRARG RGRGRGGGGG QNGKKEVVDL RSLLIHCAQA  360
VAADDRRCAG QLLKQIRLHS TPFGDGNQRL AHCFANGLEA RLAGTGSQIY KGIVSKPRSA  420
AAVLKAHQLF LACCPFRKLS YFITNKTIRD LVDNSQRVHV IDFGILYGFQ WPTLIHRFSM  480
YGSPMVRITG IEFPQPGFRP AQRVEETGQR LAAYAKHFGV PFEYKAIAKK WDAIQLEDLD  540
IDRDEVIIVN CLYRAENLHD ESVKVESCRD TVLNLIGKIN PDLFVFGIVN GAYNAPFFVT  600
RFREALFHFS SIFDMLETIV PREDEGRMFL EMEVFGREAL NVIACEGWER VERPETYKQW  660
HVRAMRSGLV QVPFDPSIMK TALHKVNTFY HKDFVIDQDN RWLLQGWKGR TVMALSVWKP  720
ESKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-353547198375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1326335RARGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010517037.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLR0HVC00.0R0HVC0_9BRAS; Uncharacterized protein
STRINGAT2G37650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein